Protein Info for Dshi_1680 in Dinoroseobacter shibae DFL-12

Annotation: ferredoxin (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 PF17650: RACo_linker" amino acids 133 to 221 (89 residues), 105.4 bits, see alignment E=2.3e-34 PF17651: Raco_middle" amino acids 226 to 382 (157 residues), 158.9 bits, see alignment E=1.8e-50 PF14574: RACo_C_ter" amino acids 390 to 661 (272 residues), 292.3 bits, see alignment E=5.5e-91

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1680)

Predicted SEED Role

"Methyltransferase corrinoid activation protein Rsph17029_1409"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLP4 at UniProt or InterPro

Protein Sequence (690 amino acids)

>Dshi_1680 ferredoxin (RefSeq) (Dinoroseobacter shibae DFL-12)
MNNQSLPQPDADPAADALVIFTPSGKRGRVPTGTSVLDAARLLDVDLDSVCGGRGICSKC
QVTPSFGEFSKHGVHARENALSEWNAVEARYHEKRGLAQGRRLGCQACILGDMVIDVPAT
SQVHKQVVRKAASQRAVTMDPATRLVLIDVAEPDMHEPSGDYERLATALDEQWQIGPVTA
PLSVLRKLQPALRRGKWQVTVAVNIADTPARVIDIWPGYHEGPLWGLAIDLGSTTIAAHL
CDLTTGQVATSAGVMNPQIRFGEDLMSRVSYAMMNADGAQAMTAAVLDALNTLATEICAE
AEVAPRDVVEAVFVCNPVMHHLLLGIDPVELGQAPFALATSGAVTLSATELGLTAVNPAA
QTYLLPCIAGHVGADAAAVALSEAPDKSDELVLIVDVGTNAEILLGNRDRVLACSSPTGP
AFEGAQISSGQRAAPGAIERVEIDPVTKEPRFRVIGCELWSDDPGFAEATAATGITGICG
SGIIEAVAEMRMAGLLDASGLIGGPEQTGTPRSIAEGRTYSYVLQDDRPAGGSLIAVTQG
DIRAIQLAKSALYAGARLLMDEMGVDTVDRVTLAGAFGAHISPKHAMVLGMIPDAPLDKV
TSAGNAAGTGARMALCSRAARAEIEQTVSKITKVETAIEPRFQEHFVAANAIPHATAPFA
HLRSVVPLPQPGFNAGGGGQPGTRRRRRRG