Protein Info for Dshi_1668 in Dinoroseobacter shibae DFL-12

Annotation: nitrite reductase (NAD(P)H), small subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF13806: Rieske_2" amino acids 5 to 101 (97 residues), 63.7 bits, see alignment E=1.4e-21 TIGR02378: nitrite reductase [NAD(P)H], small subunit" amino acids 5 to 102 (98 residues), 101 bits, see alignment E=1.8e-33 PF00355: Rieske" amino acids 5 to 90 (86 residues), 62.4 bits, see alignment E=3e-21

Best Hits

KEGG orthology group: K00363, nitrite reductase (NAD(P)H) small subunit [EC: 1.7.1.4] (inferred from 100% identity to dsh:Dshi_1668)

Predicted SEED Role

"Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLN2 at UniProt or InterPro

Protein Sequence (113 amino acids)

>Dshi_1668 nitrite reductase (NAD(P)H), small subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MSQDWIDIGELSDIPARGARVVRTAVGCVAVFRTGSDEVFALQNRCPHKGGPLSEGIVHG
KSVTCPLHNWVFSLETGEAQGADVGHVRTYPARIEAGRILLETSFLQARMAAE