Protein Info for Dshi_1658 in Dinoroseobacter shibae DFL-12

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00005: ABC_tran" amino acids 31 to 178 (148 residues), 109.3 bits, see alignment E=2.4e-35

Best Hits

Swiss-Prot: 67% identical to YFEB_YERPE: Chelated iron transport system membrane protein YfeB (yfeB) from Yersinia pestis

KEGG orthology group: K11607, manganese/iron transport system ATP-binding protein (inferred from 100% identity to dsh:Dshi_1658)

Predicted SEED Role

"Alpha-glucoside transport ATP-binding protein AglK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLM2 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Dshi_1658 ABC transporter related (RefSeq) (Dinoroseobacter shibae DFL-12)
MPEAAAIETPVPIGLRARGVTVTYRNGLTALNDASFEIPQGSITALVGVNGAGKSTLFKA
IMGFVPVAKGEIEVMGGTVAAALKANKIAYVPQNEEVDWSFPVLVEDVVMMGRYGHMGLL
RIPSAKDRQAVQEALARVGMAEFRTRQIGELSGGQRKRVFLARALAQNGQVILLDEPFTG
VDVQTEEAIIALLRDLRDEGRVMLVSTHNLGSVPEFCDRTILMKGTVLGYGPTETTFTQA
NLERAFGGVLRHFVLEGADLHDDDDARKVMIFTDDERPLVTYDEKTRTLTSPDEGDTR