Protein Info for Dshi_1647 in Dinoroseobacter shibae DFL-12

Annotation: 2-dehydro-3-deoxyglucarate aldolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03328: HpcH_HpaI
  • amino acids 18 to 243 (226 residues), 167 bits, E=2e-53

Best Hits

Swiss-Prot: 49% identical to HPCH_ECOLC: 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase (hpcH) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 100% identity to dsh:Dshi_1647)

MetaCyc: 49% identical to 4-hydroxy-2-ketopimelate aldolase monomer (Escherichia coli C)
4-HYDROXY-2-KETOPIMELATE-LYSIS-RXN [EC: 4.1.2.52]

Predicted SEED Role

No annotation

MetaCyc Pathways

• 4-hydroxyphenylacetate degradation (3/8 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Lysine degradation
• Naphthalene and anthracene degradation
• Pentose phosphate pathway
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.-

Use Curated BLAST to search for 4.1.2.- or 4.1.2.52

Sequence Analysis Tools

See A8LLL1 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Dshi_1647 2-dehydro-3-deoxyglucarate aldolase (RefSeq) (Dinoroseobacter shibae DFL-12)
MAAPENQLKQALLAGDVQIGIWLGFGAPAVAELAAGCGFDWCLVDGEHSPNDPAQMIDQL
RAMVGQGAMPIVRVPVGEDWVLKRALDLGVQTIMVPMVETAAQAQQIVRAMRYPPDGVRG
VGAALARASGYSLDAEYVTTANAQICTIVQIESHAAVRAIPEIAAVEGVDVLFIGPADLA
ADMGYPGRADAPEVDAVICAALGEIARSGKVPGVLAFSETDAVRFAAAGARFVGVGADVT
SLAVALRGLSASSRARLSSP