Protein Info for Dshi_1599 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 204 to 229 (26 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 282 (196 residues), 50.2 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 38% identical to POTB_SALTI: Spermidine/putrescine transport system permease protein PotB (potB) from Salmonella typhi

KEGG orthology group: K11071, spermidine/putrescine transport system permease protein (inferred from 100% identity to dsh:Dshi_1599)

MetaCyc: 38% identical to spermidine preferential ABC transporter membrane subunit PotB (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKX7 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Dshi_1599 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MTTRNTTARRSEAMQGYVMVSPPLIFTILLLAVPLVAILVLSFWTQNFMEFDRSFTLANY
REAVTDPIYGTLMGRSLWIAGMVTVVTVVLAFPIAYFVSFHVPQNRKALWIFLITVPFWT
SYLLRVFLWKVILGFNGVLNSGLQGLGIIEEPLTFLLYNANAVVITLAHAYAPFTILPIY
VALEKIDRSLLEAARDLGESAWGAFCRITLPLAMPGIVAATLIVFIPVIGDYVTPRLVGG
PDGLMIANMIQTQFLRLNDAPMGAALAVSAMTIVSAIALLVVFVTRNIGRAPK