Protein Info for Dshi_1587 in Dinoroseobacter shibae DFL-12

Annotation: GMP synthase, large subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain" amino acids 10 to 196 (187 residues), 192.6 bits, see alignment E=4.5e-61 PF00117: GATase" amino acids 10 to 194 (185 residues), 121.1 bits, see alignment E=1.4e-38 PF07722: Peptidase_C26" amino acids 76 to 179 (104 residues), 25.8 bits, see alignment E=2.7e-09 TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain" amino acids 210 to 520 (311 residues), 466.3 bits, see alignment E=4.8e-144 PF02540: NAD_synthase" amino acids 217 to 268 (52 residues), 22.4 bits, see alignment 1.9e-08 PF03054: tRNA_Me_trans" amino acids 224 to 256 (33 residues), 24.9 bits, see alignment (E = 4.5e-09) PF00958: GMP_synt_C" amino acids 429 to 519 (91 residues), 137.4 bits, see alignment E=4.2e-44

Best Hits

Swiss-Prot: 100% identical to GUAA_DINSH: GMP synthase [glutamine-hydrolyzing] (guaA) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to dsh:Dshi_1587)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKW5 at UniProt or InterPro

Protein Sequence (520 amino acids)

>Dshi_1587 GMP synthase, large subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MTQFDHDRLLIIDFGSQVTQLIARRLRELNVFCEIHPFQNVTDAFLADFAPKAVIFSGGP
ASVIDANSPRPPASVFELGVPILGICYGQQVMMQMLGGMVERGHGTAEFGRAYVTPQGDR
PELLNGWFLDGREQVWMSHGDHVSRIAPGFEVYGTSPNAPFAITADLARNFFAVQFHPEV
HHTPNGKTLYENFVRLAGFTGDWTMDAYREQAIAEIRAQVGDGKVICALSGGVDSSVAAV
LIHEAIGEQLTCVFVDHGLLRKNEAQEVVTMFREHYNLPLIHADETELFLSALDGQSDPE
TKRKIIGKLFIDVFEAKAKEIGGADFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLP
EKMGMKLVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITRPKLEILR
EADAVYIDQIRKYGLYDEIWQAYVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADY
YPFTHEFLGETATRIINEVQGINRVTYDITSKPPGTIEWE