Protein Info for Dshi_1583 in Dinoroseobacter shibae DFL-12

Annotation: lipoic acid synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF16881: LIAS_N" amino acids 11 to 60 (50 residues), 34 bits, see alignment 3.5e-12 TIGR00510: lipoyl synthase" amino acids 16 to 307 (292 residues), 366.6 bits, see alignment E=5.2e-114 PF04055: Radical_SAM" amino acids 75 to 238 (164 residues), 65.8 bits, see alignment E=5.7e-22

Best Hits

Swiss-Prot: 87% identical to LIPA_RUEST: Lipoyl synthase (lipA) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 100% identity to dsh:Dshi_1583)

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKW1 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Dshi_1583 lipoic acid synthetase (RefSeq) (Dinoroseobacter shibae DFL-12)
MRDLKLPEQRHPEKAHRPDNAQPRKPSWIRVKAPGGKGYTETRDIMRSHKLTTVCEEAGC
PNVGECWSQGHATMMIMGEICTRGCTFCNVATGKPDALDAFEPGRVADAVKKLGLNHVVI
TSVDRDDVEDGGAEHFAMTIRAIRRHAPDTTIEILTPDFLKCAPEALETVVAARPDVFNH
NLETVPGLYPTVRPGARYFHSLRLLQRVKELDPSMFTKSGIMVGLGEDRQGVMQVMDDMR
AADVDFLTIGQYLQPTPKHHTVDRFVTPEEFKAYEKAAYGKGFLMVSATPLTRSSYHAGD
DFARLRENRMARLAEA