Protein Info for Dshi_1581 in Dinoroseobacter shibae DFL-12

Annotation: hypoxanthine phosphoribosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 70% identical to HPRT_RHOCB: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 100% identity to dsh:Dshi_1581)

MetaCyc: 55% identical to hypoxanthine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Hypoxanthine phosphoribosyltransferase. [EC: 2.4.2.8]; 2.4.2.8 [EC: 2.4.2.8]

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

superpathway of purine nucleotide salvage (13/14 steps found)
adenine and adenosine salvage III (4/4 steps found)
adenine salvage (3/3 steps found)
guanine and guanosine salvage I (2/2 steps found)
guanine and guanosine salvage II (2/2 steps found)
xanthine and xanthosine salvage (2/2 steps found)
superpathway of guanine and guanosine salvage (2/3 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKV9 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Dshi_1581 hypoxanthine phosphoribosyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MKHDEYVIDKIISAKAIAARVEALAREIERAFAGTDKLIVIGLLRGSFVFIADLVRELDL
PVEVDFLEASSYGDGMESSREVRILKDLRGEIAGRDVLVVEDLVDTGFTLSHVTRLLASR
EPRRMETICLLDKPTRREVDVQATWIGFEIPDEFVVGYGIDYAQRNRNLPYIGKVRKL