Protein Info for Dshi_1482 in Dinoroseobacter shibae DFL-12

Annotation: TRAP dicarboxylate transporter, DctM subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 378 to 404 (27 residues), see Phobius details amino acids 424 to 447 (24 residues), see Phobius details PF06808: DctM" amino acids 12 to 441 (430 residues), 292.9 bits, see alignment E=2e-91 TIGR00786: TRAP transporter, DctM subunit" amino acids 22 to 445 (424 residues), 292.6 bits, see alignment E=2.1e-91

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1482)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LK25 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Dshi_1482 TRAP dicarboxylate transporter, DctM subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MSGVELALTGFALMLGAIFLRVPIAVAMGLTGFIGTWVVLGHPNATLSQMKTLTYDTFSS
YSLSIVPLFLLMGQFATKSGMSAALFQAASDWLGHRKGGVAMAAVGACAGFGAVCGSSLA
TASTMGQVALPEMKKRGYSDSLSTGVLAAGGTLGILIPPSVILVIYAILTQQNIVKMFIA
ALIPGIIAALGYMLTVAIYVRVKPDAATTAPRIPMADRMRTLWRIWPVVVIFGLVMGGIA
GDWNWAQDGVQALFTPTEGAAVGAVATGIYGWATGGLTWKGLLESILETAQASAMIFFIV
LGAQLFNSFLAFTQAPQQLAEWVTAQGFAPLVVLSAMLVCYLIFGCVMDSLSMILLTIPI
FFPIVMALDFGLTPEQAAIWFGILALIVVEVGLITPPVGMNLFIINSMARDVPMGRTYRG
VAPFVASDLVRVVILVAFPGITLWLVGVMF