Protein Info for Dshi_1452 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 103 to 261 (159 residues), 61.4 bits, see alignment E=5e-21

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to dsh:Dshi_1452)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJH2 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Dshi_1452 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MPPCPSARKIGTMMIQPFLISLAARLGRIGAFLWSGWAGLAALALLFAAWQAGHEAYGPF
ILSAPLDTMGTVGALAVDPAAWEIAALTLQRALSGFFLVAAAGTALGVAAGYFPAILRLV
TPLVTVLLGVPPIAWIVLAMIWFGGSDATVRTVILISALPVVFMGAARGITTRDRRLDRL
AEAFGAGPLRRFLTMGLRQTTTTLFPALALALGTAFKVAVMAELLANAGGIGGALADARI
NLDIELALAWVLIAVTLLIAVEYTLVQPVKAEIDRWRHAARPWGVKR