Protein Info for Dshi_1414 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 204 to 229 (26 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 308 to 332 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 133 to 276 (144 residues), 38.7 bits, see alignment E=4.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1414)

Predicted SEED Role

"binding-protein-dependent transport systems inner membrane component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJD4 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Dshi_1414 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MKHRTFFWFMLPSGIAMLLFIALPIVSVFVQSLFVENEKVLVEVVTSGPFGTTTQVVVDE
AATAVLNAANPLGQFNGFGTYANRNHLAFAEVAEFWRSSDSLGAFARQVYGLPFYKALTF
TLAYTFIVTPLIIALGFLIAVAVNALPRLLKGPVIFTSLLPMIITPLVGSLILFWMIDSR
GVIGKTLQFIFEDPDLSLKASPMLTWITLMVYGVWSSAPFAFVVFYAGLQTVPQDTLESA
MIDGATRWQRIRFVVLPYLMPLVTFIALIQLMDNFRVFEPIVGFNAEANATSLSWIIYND
LRGSEVALFGSAAATSMLTILGVAILLTPVLIRTWRDFSAKGH