Protein Info for Dshi_1402 in Dinoroseobacter shibae DFL-12

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 319 (274 residues), 128.6 bits, see alignment E=1.3e-41

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to dsh:Dshi_1402)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJC2 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Dshi_1402 inner-membrane translocator (RefSeq) (Dinoroseobacter shibae DFL-12)
MFGLEKKDTVLLLIVAGLTMLAPFLLNPFPEGSGMAQFNAGYPDLMQRFVIFGIFAIGFN
ILFGLTGYLSFGHAAFLGVGSYAAIWMMKLLTMNVIPAIIMAIVLAGLFSLLVGWISLRR
SGIYFSILTLAFAQMSYALAYSVLTPITGGETGLQPKVNDPRLLDPALAEGATPSANLFG
LTMKSSYELNVGGWLFTFNAGYYLAAVIMLISFYVAIRIFRSPFGMMLRAVKSNQQRMNY
TGLNSKPYTLAAFVISGMYAGLAGGLMVAMDTQVGPERMFWTASGEVVLMTILGGAGTLI
GPVLGAGMIKYMENIISKINETILHQWFAFLPDGMEDALVAMVYPFIGKGWHLTLGIIFM
LVVIFLPGGLVEGGQRIARLFGRGKKADAEGDKKSAETTPAE