Protein Info for Dshi_1375 in Dinoroseobacter shibae DFL-12
Annotation: Ornithine decarboxylase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01581, ornithine decarboxylase [EC: 4.1.1.17] (inferred from 100% identity to dsh:Dshi_1375)Predicted SEED Role
"Ornithine decarboxylase (EC 4.1.1.17) / Arginine decarboxylase (EC 4.1.1.19)" in subsystem Acid resistance mechanisms or Arginine and Ornithine Degradation or Polyamine Metabolism (EC 4.1.1.17, EC 4.1.1.19)
MetaCyc Pathways
- superpathway of arginine and polyamine biosynthesis (14/17 steps found)
- superpathway of putrescine biosynthesis (4/4 steps found)
- L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
- putrescine biosynthesis I (2/2 steps found)
- putrescine biosynthesis III (2/2 steps found)
- arginine dependent acid resistance (1/1 steps found)
- cadaverine biosynthesis (1/1 steps found)
- superpathway of polyamine biosynthesis I (5/8 steps found)
- L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (1/3 steps found)
- aminopropylcadaverine biosynthesis (1/3 steps found)
- putrescine biosynthesis II (1/3 steps found)
- L-lysine degradation X (3/6 steps found)
- spermidine biosynthesis III (1/4 steps found)
- bisucaberin biosynthesis (1/5 steps found)
- desferrioxamine B biosynthesis (1/5 steps found)
- desferrioxamine E biosynthesis (1/5 steps found)
- lupanine biosynthesis (1/5 steps found)
- superpathway of ornithine degradation (3/8 steps found)
- superpathway of polyamine biosynthesis II (3/8 steps found)
- L-lysine degradation I (2/7 steps found)
- superpathway of L-arginine and L-ornithine degradation (6/13 steps found)
- superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (4/11 steps found)
- superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)
- superpathway of L-lysine degradation (9/43 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Glutathione metabolism
- Urea cycle and metabolism of amino groups
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.1.17 or 4.1.1.19
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LJ95 at UniProt or InterPro
Protein Sequence (398 amino acids)
>Dshi_1375 Ornithine decarboxylase (RefSeq) (Dinoroseobacter shibae DFL-12) MEMTMNAYVTGLARSRPLAPIETVESRLRGFIDGRIFDRPTLVLDCDAVVAKYHALAHGL GQGTLIHYAMKANPAPEILRALAAEGCGFDAASRGEIELALAAGATAARISFGNTIKRPS DIAFAHAHGIDLFAADAEAELDKIAAHAPGARVFLRVLVGATGADWPLSRKFGCAPDTAL RLMDRAAFLGLRPVGLSFHVGSQTRDPGMWSDTLDQMAEIWHAGRARGHDLNLINIGGGF PAFYGDPILEAETYAGRVGALVRARFGDATVMAEPGRGLVAEAGMIVAEVLLVSRKSEDD LCRWVYLDIGKFSGLAETMEEAIRYQFVTPHDGGETGPCIMAGPSCDSADVLYEQRPVHL PMALQSGDRILIKATGAYTTTYSSVGFNGFPPLDLIVI