Protein Info for Dshi_1361 in Dinoroseobacter shibae DFL-12

Annotation: D-lactate dehydrogenase (cytochrome) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF01565: FAD_binding_4" amino acids 51 to 187 (137 residues), 133.9 bits, see alignment E=3.2e-43 PF02913: FAD-oxidase_C" amino acids 224 to 465 (242 residues), 223.4 bits, see alignment E=4e-70

Best Hits

Swiss-Prot: 51% identical to LDHD_MOUSE: Probable D-lactate dehydrogenase, mitochondrial (Ldhd) from Mus musculus

KEGG orthology group: K00102, D-lactate dehydrogenase (cytochrome) [EC: 1.1.2.4] (inferred from 100% identity to dsh:Dshi_1361)

Predicted SEED Role

"D-Lactate dehydrogenase, cytochrome c-dependent (EC 1.1.2.4)" in subsystem Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 1.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIY9 at UniProt or InterPro

Protein Sequence (468 amino acids)

>Dshi_1361 D-lactate dehydrogenase (cytochrome) (RefSeq) (Dinoroseobacter shibae DFL-12)
MTDQTPLRRNAAGIATALDVLRQKFGARLQTGAALREQHGHTTTWLPNQPPDAVFLPRET
AEVQDVLRICTAYGMPLVPFGTGTSLEGHVNAPLGGLSLDFAEMNQVLAIHPEDMDCVVQ
PGITRKALNEELRATGLFFPVDPGADASLGGMAATRASGTNAVRYGTMRDVVLALEAVTA
DGRVIRTAKRARKTSAGYDLTRLLVGSEGTLGVITELTLKLSGIPEAVAGATCSFASVEA
ACAAVIATIQYGVPVARIEFLDALSVRSINAYSKLSLPEAPLLLLEFHGSEAGVAEQSET
FGEIAADHGALAFDWTSDAEARAKMWQARHDAYWAMRALRPGFDAFVTDVCVPVSRLAEA
VSAAAERAEADGIIAPTLGHVGDGNFHVALLIDPDDPGGRARAESYIGWLNDLAISLDGT
CTGEHGIGQGKVKYLARELGANTVDVMAALKSAMDPDNILNPGKLFQG