Protein Info for Dshi_1345 in Dinoroseobacter shibae DFL-12

Annotation: Sec-independent protein translocase, TatC subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 116 to 147 (32 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details PF00902: TatC" amino acids 16 to 150 (135 residues), 132.7 bits, see alignment E=8.4e-43 amino acids 207 to 281 (75 residues), 71.8 bits, see alignment E=3.6e-24

Best Hits

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 100% identity to dsh:Dshi_1345)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIX3 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Dshi_1345 Sec-independent protein translocase, TatC subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MSKPDEIEDSSAPLIEHLAELRTRLIRSVLAFIVGIVLAFTVAEPILQFLLVPIEETLRE
LGDPSPTLQYTSPQEYLFTLFRISMVFGFALSFPVIAHQLWRFVAPGLYRTEKAAFLPFI
IASPFMFLLGASFAHFVVTPLAMAFFLGFADVSSIFANLLSGAAPDVPDGVILVPPETGP
PVISPDVDGLSNMPIIVPETEEGVRITFFGKVNESLDITLKFIMAFGLCFQLPVLLTLMG
KAGLVSAEGLGTVRKYAMVGILLLAALVTPPDVVTQLILFVVVYGLYEVSIFLVRRVEKK
REKELRAQGLWDEDDDAPDLEDDPLYDEFRDDDDPAAKPGPGGNKI