Protein Info for Dshi_1340 in Dinoroseobacter shibae DFL-12

Annotation: Na+/solute symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 394 to 412 (19 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1340)

Predicted SEED Role

"Na+/proline symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIW8 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Dshi_1340 Na+/solute symporter (RefSeq) (Dinoroseobacter shibae DFL-12)
MMTIYVALAFLVVALASVAVAPRRASVEGFFGGASATGAAPGLWTLVLSQVTTWIFARSL
MNAAILGYFYGMAGTLAYAAYYGSFLTGGFIVARIRARGGRSVQDWLGAQFGRTGQGSYN
VVIALRLLSEVFANLLVVGLIFNALLPESGAGTIAVLAVAVLGLAYSAWGGLSAALRTDV
VQMLLFLVVFGIAFAALVTGPDFSLAAVLTAEGTAGARQGWILLAVAALQVYSYPAHDPV
MMDRGFLADAKTTRRSFLHAFWISVLCILGFGMFGIQASLVGAEYEEELLGTWAVMFPPW
IWAALMLSLLISALSTLDSALSSAARVTVEELRLLPRSLTGGRIAMVGFMTLGAGLTLWG
NASLFDAVAVSGTASMFLTPVLVVGLVMGRPIPLWSYLVAFGAAILGAAAYFLRANGIVA
ALLPDAHKYDQLLVICIAVLAVGFAAVIAGARGRRLAAAGQR