Protein Info for Dshi_1329 in Dinoroseobacter shibae DFL-12

Annotation: proton-translocating NADH-quinone oxidoreductase, chain N (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 402 to 422 (21 residues), see Phobius details amino acids 445 to 466 (22 residues), see Phobius details TIGR01770: proton-translocating NADH-quinone oxidoreductase, chain N" amino acids 7 to 459 (453 residues), 462.4 bits, see alignment E=1e-142 PF00361: Proton_antipo_M" amino acids 123 to 417 (295 residues), 298.9 bits, see alignment E=1.9e-93

Best Hits

Swiss-Prot: 73% identical to NUON_JANSC: NADH-quinone oxidoreductase subunit N (nuoN) from Jannaschia sp. (strain CCS1)

KEGG orthology group: K00343, NADH dehydrogenase I subunit N [EC: 1.6.5.3] (inferred from 100% identity to dsh:Dshi_1329)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain N (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIV7 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Dshi_1329 proton-translocating NADH-quinone oxidoreductase, chain N (RefSeq) (Dinoroseobacter shibae DFL-12)
MISQDIAIVMPEIALAIFAMAGLMYGVYTGKDRTAPLLVWLTAAVFVGLAFWIGISAEGD
RVAFGGMFVDDSFARFAKITILLSAAAILVMSLDHMSKLGILKFEYPILIALAVVGMMMM
VSAGDLMALYMGLELQSLALYVVASIHRDDSRSTEAGLKYFVLGALSSGMLLYGASLTYG
YAGTTLFSGIITTATEGEISMGLLFGLVFLTAGLAFKVSAAPFHMWTPDVYEGSPTPVTA
LFATAPKVAAMALFARVVHDAFGNAIGDWQQIVAFLAVLSMFLGSIAAIGQTDIKRLMAY
SSIAHMGFALMGLAAGTVGGVQAMLIYMAIYVTMNIGTFAFILSMEKDGVAVTEIASLNQ
FASREPTKAMALLLLMFSLAGIPPLLGFFGKYTVLLAAVDGGLTWLAIAGVMASVIGAFY
YLRIVYYMYFGKADDALEGSMPMVQYGFLMASAVIMLVGIVNFFGVEGMALAAAESLVR