Protein Info for Dshi_1322 in Dinoroseobacter shibae DFL-12

Annotation: NADH-quinone oxidoreductase, chain I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 21 to 142 (122 residues), 172.5 bits, E=1.2e-55
• PF13237: Fer4_10
  • amino acids 62 to 115 (54 residues), 26.9 bits, E=1.9e-09
• PF00037: Fer4
  • amino acids 62 to 81 (20 residues), 24 bits, see alignment (E = 1.3e-08)
  • amino acids 98 to 119 (22 residues), 34.5 bits, see alignment (E = 6.1e-12)
• PF12800: Fer4_4
  • amino acids 63 to 77 (15 residues), 17.8 bits, see alignment (E = 1.7e-06)
  • amino acids 102 to 116 (15 residues), 13.6 bits, see alignment (E = 3.7e-05)
• PF13187: Fer4_9
  • amino acids 64 to 119 (56 residues), 34.1 bits, E=1.1e-11
• PF12838: Fer4_7
  • amino acids 64 to 118 (55 residues), 49.1 bits, E=3.2e-16

Best Hits

Swiss-Prot: 100% identical to NUOI_DINSH: NADH-quinone oxidoreductase subunit I (nuoI) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 100% identity to dsh:Dshi_1322)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See A8LIV0 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Dshi_1322 NADH-quinone oxidoreductase, chain I (RefSeq) (Dinoroseobacter shibae DFL-12)
MAQMDYTRAAKYFLLFDFFAGFKLGLKYFFKPKATLAYPHEKGPLSPRFRGEHALRRYPN
GEERCIACKLCEAICPAQAITIDAEPRDDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIV
EGPNFEFATETREELFYDKEKLLDNGERWEAEIARNLELDAPYR