Protein Info for Dshi_1311 in Dinoroseobacter shibae DFL-12

Annotation: NADH dehydrogenase I, D subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01962: NADH dehydrogenase (quinone), D subunit
  • amino acids 19 to 404 (386 residues), 575.1 bits, E=3.3e-177
• PF00346: Complex1_49kDa
  • amino acids 133 to 404 (272 residues), 393.4 bits, E=2.3e-122

Best Hits

Swiss-Prot: 100% identical to NUOD_DINSH: NADH-quinone oxidoreductase subunit D (nuoD) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K00333, NADH dehydrogenase I subunit D [EC: 1.6.5.3] (inferred from 100% identity to dsh:Dshi_1311)

MetaCyc: 72% identical to MbhL (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain D (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism
• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Sequence Analysis Tools

See A8LIT9 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Dshi_1311 NADH dehydrogenase I, D subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MMDGTNFDDALTGEQKIRNFNINFGPQHPAAHGVLRLVLELDGEIVERCDPHIGLLHRGT
EKLMESRTYLQNLPYFDRLDYVAPMNQEHAWCLAIEKLTGTVVPRRGSLIRVLYCEIGRI
LNHLLNITTQAMDVGALTPPLWGFEEREKLMVFYERACGARLHAAYFRPGGVHQDLPPDL
LDDIEAWSHEFPSVMDDIDGLLTENRIFKQRNCDIGVVTEEEILEWGYSGVMVRGSGLAW
DLRRAQPYECYDEFDFQIPVGKNGDCYDRYLVRMQEMRESLKIIQQAIVKLRETKGDVLA
RGKLTPPSRADMKTSMEALIHHFKLYTEGFHVPAGEVYAAVEAPKGEFGVFLKSDGTNRP
YRAKIRAPGYLHLQSMDHVAKGHQLADVAAIIGTMDVVFGEIDR