Protein Info for Dshi_1293 in Dinoroseobacter shibae DFL-12

Annotation: glucosamine--fructose-6-phosphate aminotransferase, isomerizing (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 TIGR01135: glutamine-fructose-6-phosphate transaminase (isomerizing)" amino acids 2 to 606 (605 residues), 763 bits, see alignment E=1.2e-233 PF13522: GATase_6" amino acids 65 to 191 (127 residues), 67.5 bits, see alignment E=1.9e-22 PF13537: GATase_7" amino acids 89 to 196 (108 residues), 52.1 bits, see alignment E=9.6e-18 PF01380: SIS" amino acids 286 to 413 (128 residues), 97.5 bits, see alignment E=8.3e-32 amino acids 457 to 587 (131 residues), 75.1 bits, see alignment E=7e-25

Best Hits

Swiss-Prot: 57% identical to GLMS_ZYMMO: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 100% identity to dsh:Dshi_1293)

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIS1 at UniProt or InterPro

Protein Sequence (606 amino acids)

>Dshi_1293 glucosamine--fructose-6-phosphate aminotransferase, isomerizing (RefSeq) (Dinoroseobacter shibae DFL-12)
MCGIVGVLGHNQAAPLLVEALKRLEYRGYDSAGVATVQDGHLDRRRAMGKLVNLSDLLVE
NPLAGKAGIGHTRWATHGVPSVSNAHPHQAGPVAVVHNGIIENFRALRAELIADGANFES
ETDTETIAQLCARELRAGATPVEAARRTIARLEGAFALCFLFDGHDDLLIAARKGSPLAI
GHGDGEMFVGSDALALHPMTDRITYLEEGDWAVVTRAGVQVFDARDTEVLRPETHARIDG
TQIGKGGHRHFMAKEIAEQPSVISDVLGHYTKTGTRIDMPAELPDFAQIDRLILVACGTA
FYACQTAKYWFEQLTGLPVDIDIASEFRYRSPPIGPRTAALFVSQSGETADTLAALRYCA
GKADHILSICNVPQSSIARESTVALPTLAGVEIGVASTKAFTCQLTVLALLALHAARQRG
HCDDATLAEHLTALRGLPGLLNLALGQEAEIETVSRELAEARDILFLGRGAMYPIALEGA
LKLKEISYIHAEGYASGELKHGPIALVDPAVPVIVFAPTDPLFDKTVSNMQEVMARQGKV
LLVSDATGLDTAGPGSWATIQMPHVSPFLAPILYAIPAQLLAYHTAVAKGTDVDQPRNLA
KSVTVE