Protein Info for Dshi_1271 in Dinoroseobacter shibae DFL-12

Annotation: Xylose isomerase domain protein TIM barrel (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF01261: AP_endonuc_2" amino acids 30 to 284 (255 residues), 112 bits, see alignment E=2.1e-36

Best Hits

KEGG orthology group: K03335, inosose dehydratase [EC: 4.2.1.44] (inferred from 100% identity to dsh:Dshi_1271)

Predicted SEED Role

"Inosose dehydratase (EC 4.2.1.44)" in subsystem Inositol catabolism (EC 4.2.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIF9 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Dshi_1271 Xylose isomerase domain protein TIM barrel (RefSeq) (Dinoroseobacter shibae DFL-12)
MTIRIGNAPCSWGVEFAGDPRNPDWRQVLRETAAAGYTGIELGPIGFMPEDPPQVADALA
EHELELIGGVVFRPFHDRAAWEEVLDASVRTCKALVAHGAQHLVLIDSISPRRAPTAGRA
GAAEQMDAVEWAAFRDRIAHVARMGADEYGLTVGIHAHAAGFMDFEPELERLLDEVDDSI
LKICFDTGHHSYAGFDPVAFMQRHLPRISYMHFKDIDPAVKANVIARGTGFYDACGQGIF
CNLGEGDVNFPRVRQLLIDHGFDGWCTVEQDCDPTLPDTDPFGDAMTNRAYLRAIGFE