Protein Info for Dshi_1248 in Dinoroseobacter shibae DFL-12

Annotation: extracellular solute-binding protein family 1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01547: SBP_bac_1" amino acids 42 to 330 (289 residues), 131.9 bits, see alignment E=5.1e-42 PF13416: SBP_bac_8" amino acids 48 to 349 (302 residues), 79.4 bits, see alignment E=4e-26

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 100% identity to dsh:Dshi_1248)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, sugar-binding protein" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LID6 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Dshi_1248 extracellular solute-binding protein family 1 (RefSeq) (Dinoroseobacter shibae DFL-12)
MRPSTKSLLAALATSVAFTVPAAAELTGELKIFSDMSNPAPRATMEGLVAGFQEQHPDLD
IELTIIDREAYKTQIRNFLTANTPDVANWYAGNRMLPFVEAGLFEDISDLWDDEKSANLA
STKPSMTIDGKQWGVPYTYYQWGVYYREDIYNDLGLTEPTTWAEEKANCQTLLENGIKCY
TIGTKFLWTAGGWFDYLNLRTNGYEFHMALTNGEVAWTDDRVRQTMANWRELIDMGAFID
NHQTYSWQEALPFMVRGEAAAYLMGNFAVSHLREAGLGDDQLGFYQFVEITPGIPKAEDA
PTDTFHIPAQAANKEAARAFLRYVTSPEVQTQINAGDQLGQLPVHKAASVDDDKFLKEGF
DMLSNAYALAQFFDRDAPAEMAKAGMEGFQEFMVKPDNLDRILERMERVRQRVY