Protein Info for Dshi_1243 in Dinoroseobacter shibae DFL-12

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF08659: KR" amino acids 15 to 177 (163 residues), 57.8 bits, see alignment E=2.9e-19 PF00106: adh_short" amino acids 17 to 201 (185 residues), 164.9 bits, see alignment E=3.2e-52 PF01370: Epimerase" amino acids 17 to 106 (90 residues), 23.9 bits, see alignment E=5.3e-09 PF13561: adh_short_C2" amino acids 24 to 254 (231 residues), 190.4 bits, see alignment E=8e-60

Best Hits

Swiss-Prot: 49% identical to GALD_RHIME: Probable galactose dehydrogenase GalD (galD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1243)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LID1 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Dshi_1243 short-chain dehydrogenase/reductase SDR (RefSeq) (Dinoroseobacter shibae DFL-12)
MPAPRNATFHDLDGASVFVTGGGSGIGAALTDGFLAQGAQVAFIGRSDASAFVAKMRAAH
GRAPLFVQGDITDTDALRAAIAQATAAHGPITALVNNAANDKRHSTAEVTPEFWDQMQAI
NLKAYFFAAQAVTPGMAEAGGGAIVNFSSISYMMGNAGYPAYTAANAGITGLTRSLAREF
GPDGIRVNALAPGWVLTPKQLEMWATPEDLAAHLDRQCLKTHLAPEDIVEATLFLASGAS
KMMTGQCMVVDGGVVVTG