Protein Info for Dshi_1236 in Dinoroseobacter shibae DFL-12

Annotation: DMSO reductase anchor subunit (DmsC) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 162 to 178 (17 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details PF04976: DmsC" amino acids 43 to 274 (232 residues), 50 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: K07308, anaerobic dimethyl sulfoxide reductase subunit C (DMSO reductase anchor subunit) (inferred from 100% identity to dsh:Dshi_1236)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIC4 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Dshi_1236 DMSO reductase anchor subunit (DmsC) (RefSeq) (Dinoroseobacter shibae DFL-12)
MHPARSVILFTSLSGIGFGFLIWLGLGIPKAVGGVGAVYYALAFALTVGGLIASTFHLGN
PQRAWRAFSQWRTSWLSREAVLAVLALAIMALHGAAAVLLGYQPAFLGLLGAALCLATVL
ATAMIYTQLKTVPRWNQPSTPILFALLSLAGGALLAGRMDPALWLLIAAGAVQLWAWLQG
DKAFAENATTLATATRIGEEVRAFEPPHTGGNYLMREMVFQVGRKHALKLRAIAFALMIA
LPVLIILVNDKHLMVGIAVLLHFAGVLVARWLFFAEAEHVVGLYYGRAQTPLSSE