Protein Info for Dshi_1213 in Dinoroseobacter shibae DFL-12

Annotation: ATPase associated with various cellular activities AAA_5 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF07728: AAA_5" amino acids 45 to 197 (153 residues), 52.6 bits, see alignment E=7.6e-18 PF00004: AAA" amino acids 46 to 197 (152 residues), 34.6 bits, see alignment E=3.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1213)

MetaCyc: 57% identical to CoxD sulfurtransferase monomer (Afipia carboxidovorans)
RXN-21549

Predicted SEED Role

"Carbon monoxide oxidation accessory protein CoxD"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIA1 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Dshi_1213 ATPase associated with various cellular activities AAA_5 (RefSeq) (Dinoroseobacter shibae DFL-12)
MGFHPPSRQGMTDWTSLQTAMAEHGYVASDDLAMALHIARSLGRPLLLEGAAGVGKTEVA
RVLAAVEDTRLIRLQCYEGLDASHAIYEWNYPRQLLAIRAAAEDGESARAAETRVFSEDY
LLERPLLAAIRQDRAPVLLIDEIDRADEEFEAYLLEVLSEFQITVPELGTLTAVTRPTVI
LTANGTRDLSDALRRRCVYAYVEYPSREVELSILLARCPEIADQLAAQIVGFVQAVRRED
LEKKPGIAEMLDFAAALSGLGIADLNDDPVVLGATLATLLKTRQDRDTLSVEVAQRLAGK
AA