Protein Info for Dshi_1172 in Dinoroseobacter shibae DFL-12

Annotation: peptide chain release factor 2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 TIGR00020: peptide chain release factor 2" amino acids 3 to 361 (359 residues), 499.1 bits, see alignment E=3.4e-154 PF03462: PCRF" amino acids 30 to 218 (189 residues), 189.2 bits, see alignment E=7.3e-60 PF00472: RF-1" amino acids 226 to 335 (110 residues), 136 bits, see alignment E=5.8e-44

Best Hits

Swiss-Prot: 84% identical to RF2_ROSDO: Peptide chain release factor 2 (prfB) from Roseobacter denitrificans (strain ATCC 33942 / OCh 114)

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 100% identity to dsh:Dshi_1172)

Predicted SEED Role

"Peptide chain release factor 2" in subsystem Programmed frameshift

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHW7 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Dshi_1172 peptide chain release factor 2 (RefSeq) (Dinoroseobacter shibae DFL-12)
MRAEIQNTVEAIRKSLDLLAQRLDYETAPHRLEEFDAMIEDPNLWNDQARAQKLMRDRQM
LVDAMKTYEGIKQELEDNIELIELGEMEADAEVVTDAEEALKSLAETAAKKEIEALLDGE
ADGNDTFLEINSGAGGTESCDWASMLARMYVRWAEAKGYTVELQSQSPGEEAGIKSAAYK
ISGPNAYGWLKSESGVHRLVRISPYDSAARRHTSFSSVWVYPVVDDNIEIEVNPADIRID
TYRSSGAGGQHVNTTDSAVRITHVPTGIVTTSSEKSQHQNRDIAMKALKSRLYQMELDRR
NAAINEAHEAKGDAGWGNQIRSYVLQPYQMVKDLRTGYETSDTAGVLDGDLDGLMSATLA
QQVAGKSRSEAQGAD