Protein Info for Dshi_1158 in Dinoroseobacter shibae DFL-12

Annotation: Inosine/uridine-preferring nucleoside hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01156: IU_nuc_hydro
  • amino acids 11 to 308 (298 residues), 356.9 bits, E=5.9e-111

Best Hits

Swiss-Prot: 54% identical to YHD6_SCHPO: Uncharacterized protein C1683.06c (SPBC1683.06c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01239, purine nucleosidase [EC: 3.2.2.1] (inferred from 100% identity to dsh:Dshi_1158)

MetaCyc: 49% identical to pyrimidine-specific ribonucleoside hydrolase RihA (Escherichia coli K-12 substr. MG1655)
Uridine nucleosidase. [EC: 3.2.2.3]; 3.2.2.3 [EC: 3.2.2.3]

Predicted SEED Role

"Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)" in subsystem Purine conversions or Queuosine-Archaeosine Biosynthesis (EC 3.2.2.1)

MetaCyc Pathways

• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• superpathway of pyrimidine ribonucleosides salvage (8/10 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• pyrimidine ribonucleosides salvage II (2/2 steps found)
• pyrimidine ribonucleosides salvage III (2/2 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• superpathway of purines degradation in plants (13/18 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.1 or 3.2.2.3

Sequence Analysis Tools

See A8LHV3 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Dshi_1158 Inosine/uridine-preferring nucleoside hydrolase (RefSeq) (Dinoroseobacter shibae DFL-12)
MTATPTPPRKIIIDTDPGQDDAVAILLALACPEALEVLGITAVAGNVPLALTARNARIVC
ELADKPEVPVFAGCDRPLARALVTAEHVHGKTGLDGPVLPEPTMPLQDQHAVDFLIETLR
REPTGTVTLCPLGPLTNIATAFAKAPDIIPRVAEIVLMGGAYFEVGNITPAAEFNIYVDP
EAAKAVFGAGAPLVVMPLDVTHKALTTAPHIAGFRAMGTRVGEMVAAWTDFFERFDKEKY
GSEGAPLHDPCVIAWLLAPELFTGRHINVEIEVDSPLTRGMTVADWWGVTDRAANALFIG
DVDAEGFFALLTDRIARL