Protein Info for Dshi_1152 in Dinoroseobacter shibae DFL-12

Annotation: phosphoadenosine phosphosulfate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR00434: phosophoadenylyl-sulfate reductase" amino acids 41 to 234 (194 residues), 168.8 bits, see alignment E=8e-54 PF01507: PAPS_reduct" amino acids 43 to 210 (168 residues), 153.8 bits, see alignment E=2.5e-49

Best Hits

Swiss-Prot: 51% identical to CYSH_RHILO: Phosphoadenosine phosphosulfate reductase (cysH) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 100% identity to dsh:Dshi_1152)

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) / Adenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.10)" in subsystem Cysteine Biosynthesis (EC 1.8.4.10, EC 1.8.4.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.10 or 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHU7 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Dshi_1152 phosphoadenosine phosphosulfate reductase (RefSeq) (Dinoroseobacter shibae DFL-12)
MPLEAPLPPVAERVAHLNHRYRHHSATAVVERALNDPTVGHTALVSSFGAESVVLLHMIA
RRDPDTPVLFIDTEMLFPETLAYQRDVSERLGLRNLRVIRAGAEAVRATDPEGTLHQRDP
DACCALRKTAPLDAALSRFDAWITGRKRFQAGSRAALEFFEADGPSRIKVNPLAHWTPGD
VQDYMTNNRLPRHPLVARGYPSIGCAPCTSKVAPGEDPRAGRWRDADKEECGIHFINGKA
VRGPLPTGDAA