Protein Info for Dshi_1139 in Dinoroseobacter shibae DFL-12

Annotation: peptidase U62 modulator of DNA gyrase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF01523: PmbA_TldD_1st" amino acids 33 to 93 (61 residues), 49 bits, see alignment E=8.5e-17 PF19290: PmbA_TldD_2nd" amino acids 129 to 229 (101 residues), 66.3 bits, see alignment E=4.7e-22 PF19289: PmbA_TldD_3rd" amino acids 237 to 470 (234 residues), 214.7 bits, see alignment E=1.5e-67

Best Hits

KEGG orthology group: K03568, TldD protein (inferred from 100% identity to dsh:Dshi_1139)

Predicted SEED Role

"TldD protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHT4 at UniProt or InterPro

Protein Sequence (473 amino acids)

>Dshi_1139 peptidase U62 modulator of DNA gyrase (RefSeq) (Dinoroseobacter shibae DFL-12)
MTDAAFRPFETSLDPDVALRVLREAVAGADDGELFLERRRSESLLLDDGRIKTANYDASE
GFGLRAVRGETAGYAHSTELSEAALRRAATTARLAVGDGGGVLAEAPGATNRRLYSDENP
MDAAAFGVKIETLREIDAYVRALDPRVVQVSASLAASIQEVEILRPEGHRVRDVRPMTRL
NVSIIVEQDGRRESGSAGGGGRYGLASLMGAEHWQGVAREALRVAVVNLDAEPAPAGVMD
VVLGPGWPGILLHEAVGHGLEGDFNRKKSSAFAGLMGQRVAAPGVTVLDDGTIPDRRGSL
TVDDEGTPSHKTTLIEDGILVGFMQDRQNARLMGVEATGNGRRESYAHIPMPRMTNTYML
GGDAAPREIVADLKDGIYAVGFGGGQVDITNGKFVFSCTEAYRVKNGKVGAPVKGATLIG
DGPTAMQQIRAIGNDMALDPGMGNCGKAGQWVPVGVGQPTLMIGGLTVGGSAA