Protein Info for Dshi_1121 in Dinoroseobacter shibae DFL-12

Annotation: peptidase A24A prepilin type IV (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details PF01478: Peptidase_A24" amino acids 15 to 115 (101 residues), 42.9 bits, see alignment E=2.9e-15

Best Hits

KEGG orthology group: K02278, prepilin peptidase CpaA [EC: 3.4.23.43] (inferred from 100% identity to dsh:Dshi_1121)

Predicted SEED Role

"Type IV prepilin peptidase TadV/CpaA" in subsystem Widespread colonization island

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHR6 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Dshi_1121 peptidase A24A prepilin type IV (RefSeq) (Dinoroseobacter shibae DFL-12)
MAVTVSQALWFLPFILPICLFVAWSDMKFMRIPNRSVLLLLGMFAIVGLLALPLLDYAWR
WVHVIAVLAVGFVMSSAGLVGAGDAKFAAAMAPFVALQDALLVVVLFSAILLGAFATHRL
ARMLPAVRRLTPDWESWTRKRDFPMGLALSGTLIFYFLLPVLLPQVTLS