Protein Info for Dshi_1114 in Dinoroseobacter shibae DFL-12

Annotation: tRNA(Ile)-lysidine synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 PF00733: Asn_synthase" amino acids 9 to 152 (144 residues), 24.5 bits, see alignment E=2.1e-09 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 25 to 204 (180 residues), 163.6 bits, see alignment E=2.5e-52 PF01171: ATP_bind_3" amino acids 25 to 202 (178 residues), 168.8 bits, see alignment E=1.1e-53

Best Hits

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 100% identity to dsh:Dshi_1114)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHQ9 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Dshi_1114 tRNA(Ile)-lysidine synthetase (RefSeq) (Dinoroseobacter shibae DFL-12)
MTDPAAPGQALAEAMQRWVPDARRIGVAMSGGGDSMALLHLLADWAAQSGAELRAASVDH
GLRPEAADEIALAAKTCAALGIPHDSLTWDEAPAGNLQAAARDARYRLLSDWAQAQGCAV
VCLGHTQDDQAETVLLRLLRGSGVDGLAAMRPRTLRAGTVWLRPLLAVSRAALRADLTAR
GVAWAEDPSNADLRFDRVRVRQAMAALDLPVARLADTAQAMARAQEALGRRAAEAAQAGA
VRFEDGDILLTADALSALDAETRLRLLAEALRWVAGAAYRPRLSALTGVWDGLEAGQGAT
LHGCRLLAGVSAWRVCREYRAVAALEVPAGALWDGRWQLRLAKDETRPDVTVRALGQAGL
GQITRPDPGPPHPSLMSTPALWRGDEVLSVPRLNWGLSSRVDRQPEPASFISGLIPH