Protein Info for Dshi_1113 in Dinoroseobacter shibae DFL-12

Annotation: Tol-Pal system YbgF (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02795: tol-pal system protein YbgF" amino acids 149 to 257 (109 residues), 102.2 bits, see alignment E=1.4e-33 PF13174: TPR_6" amino acids 151 to 182 (32 residues), 13 bits, see alignment 3.7e-05 amino acids 224 to 254 (31 residues), 26.3 bits, see alignment 2.1e-09 PF13432: TPR_16" amino acids 153 to 211 (59 residues), 31.7 bits, see alignment E=4.2e-11 amino acids 198 to 249 (52 residues), 21 bits, see alignment 9.3e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1113)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHQ8 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Dshi_1113 Tol-Pal system YbgF (RefSeq) (Dinoroseobacter shibae DFL-12)
MRRIVGPAMGVLLLSSVTVTAQDRDQTLADIRQELSVLYVELQSLKREQSTTGAPQISLP
PNALDRLNTLEQELSRLTAKTEQLEFRIDRIVRDGTNRIGDLEFRLVELEGGDLSQLGET
TTLGGEDVPRPAPPVPGPGPETPQLAVAEQADFDAAQALLDNGDAAGAAEAFAAYTQTYP
GSPLVAEAHYLRGQAEAAQGQWSRAARAYLESFSGSPDGPRAPEALYRLGLSLAELGQRD
EACITLREVSVRFPGGAPSIGANTARGELACP