Protein Info for Dshi_1103 in Dinoroseobacter shibae DFL-12

Annotation: crossover junction endodeoxyribonuclease RuvC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02075: RuvC
  • amino acids 3 to 149 (147 residues), 148.9 bits, E=5e-48
• TIGR00228: crossover junction endodeoxyribonuclease RuvC
  • amino acids 3 to 154 (152 residues), 147 bits, E=2.1e-47

Best Hits

Swiss-Prot: 100% identical to RUVC_DINSH: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 100% identity to dsh:Dshi_1103)

MetaCyc: 47% identical to crossover junction endodeoxyribonuclease RuvC (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10 or 3.1.22.4

Sequence Analysis Tools

See A8LHP8 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Dshi_1103 crossover junction endodeoxyribonuclease RuvC (RefSeq) (Dinoroseobacter shibae DFL-12)
MRVLGIDPGLRNLGWGVISVQGSRLRHVANGQIRSEGSELAQRLLSLYRQLTEVVAGHAP
DAAAVEHTFVNKDATGTLKLGQARGIALLVPAAAGLEVAEYAPNHVKKSVVGVGHAAKEQ
VQHMVKLQLPGVVLAGADAADALAIAICHAHHLQSRGKVVAVNRTVAAPDGLRSVS