Protein Info for Dshi_1097 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF395 YeeE/YedE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 201 to 226 (26 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 321 to 344 (24 residues), see Phobius details PF04143: Sulf_transp" amino acids 33 to 339 (307 residues), 171.3 bits, see alignment E=1.9e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1097)

Predicted SEED Role

"Lipocalin-related protein and Bos/Can/Equ allergen" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LHP2 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Dshi_1097 protein of unknown function DUF395 YeeE/YedE (RefSeq) (Dinoroseobacter shibae DFL-12)
MDILPLVDGIGEAPTAALFGLITGMVLGFAAQRSSFCLRAACVEFARGQFGRRMAVWLLC
FSTALVWVQGATLLGLMRVEDARMMAVTGSWSGAILGGLMFGVGMVLARGCSGRLLVLAA
TGNLRSVVSGLIFAVVAIMALQGVLAPLRDWLAALWMTEGGRNVNLLNALGLPRGSGLVL
GLVLAVLALEIARRNRIGTRVLVMASGVGFAVALGWVLTFALSAVAFDPVQIESVTFTGP
SANTLMFFLIPNPVLEFDIGLVPGVFLGAFLGAWIGGDLKLQGFEGAGSMTRSITGAALM
GFGGMLAGGCAIGAGVTGGSIFVGTAWLALTCMWIGAVLTDLLVDQRGIRGVPAE