Protein Info for Dshi_1064 in Dinoroseobacter shibae DFL-12

Annotation: Holliday junction resolvase YqgF (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details PF03652: RuvX" amino acids 21 to 151 (131 residues), 140.4 bits, see alignment E=2.4e-45 TIGR00250: putative transcription antitermination factor YqgF" amino acids 22 to 151 (130 residues), 120.3 bits, see alignment E=2.9e-39

Best Hits

Swiss-Prot: 73% identical to YQGF_ROSDO: Putative pre-16S rRNA nuclease (RD1_1766) from Roseobacter denitrificans (strain ATCC 33942 / OCh 114)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 100% identity to dsh:Dshi_1064)

Predicted SEED Role

"Putative Holliday junction resolvase YggF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSJ2 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Dshi_1064 Holliday junction resolvase YqgF (RefSeq) (Dinoroseobacter shibae DFL-12)
MEMIFDDLAAFRAVVPAGRALMGLDLGTATIGVAVSDLMWSVATPLETVKRKKFGLDAAR
LEALMDARDVGGLILGLPRNMDGSEGPRAQSTRAFARNFTARRPIPIAFWDERLSTVAAE
RALLEADTSRARRAEVIDHVAASYILQGALDRFGHMRREALDE