Protein Info for Dshi_1040 in Dinoroseobacter shibae DFL-12

Annotation: aldehyde oxidase and xanthine dehydrogenase molybdopterin binding (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 PF01315: Ald_Xan_dh_C" amino acids 23 to 134 (112 residues), 72.2 bits, see alignment E=6.6e-24 PF02738: MoCoBD_1" amino acids 155 to 399 (245 residues), 214.8 bits, see alignment E=1.6e-67 PF20256: MoCoBD_2" amino acids 431 to 693 (263 residues), 218.7 bits, see alignment E=1.9e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1040)

Predicted SEED Role

"Possible hypoxanthine oxidase XdhD (EC 1.-.-.-)" in subsystem Purine conversions (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSG8 at UniProt or InterPro

Protein Sequence (763 amino acids)

>Dshi_1040 aldehyde oxidase and xanthine dehydrogenase molybdopterin binding (RefSeq) (Dinoroseobacter shibae DFL-12)
MARPETRFGTAQTRDEDGRLVRGAGCFVADVPAEGALWMEVVRSPYPAGRITALDLDAAR
AMPGVVCVLSGADQAGLRPFPLRYVPKGCDVVPTPFLPMATDRVTWVGEPVAVVVAETAG
QASDAADAVVLEVAEAPVVTDARTGAAPEAPRVWPDRDSNIAFTYELGDRDAFEAAAARA
AHVTRARIEISRVAAMTLEPRGALATCSPEGHMTLWTGTQAPHRVQGELAHVLDLPLDRI
RVRKTDTGGSFGMRNGAFPEDALALLAARATGRPVHWQGTRSEGFLADTASREQSVDAAL
ALDADGTFLALQVDGYAPIGAQMGQMSGHPMTSNLPGLAGVYRTPVIHAVMRGVHVNAMH
MAPYRGAGRPEAIYVIERMVELAAAETGRDPVALRLRNMIGPDQMPWATPHGFTYDSGDF
PTALRAALAGADAAGFAARREAARARGRLRGLGIACAIEPAGGGPKGAQLPEYAQLIAGP
EGLEIRTGAGDAGQGHATAFAQIAERLLGWRGPVTVRGGDTGEIARGTGTFGSRTMGSVG
AAMQAGSAQILEAARPEAADLLEVAARDLVFAQGAFRVAGTDRAIPLAEVTARTGRTFTA
EAFVATEAGTFPNGAHVAEVEVDPDTGAVQLAAYTVADDVGTVINPLLVEGQVHGGVAQG
LGQALMERIVHDADAALLTGSLMDYAVPRATDLCRIEVLHTPTPTTANPLGVKGAGESGT
VGALAAVMNAVCDAIGPEAARRLQMPASPHRVWAALNPTKEET