Protein Info for Dshi_1037 in Dinoroseobacter shibae DFL-12

Annotation: TRAP dicarboxylate transporter, DctM subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 46 to 75 (30 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 322 to 349 (28 residues), see Phobius details amino acids 361 to 383 (23 residues), see Phobius details amino acids 403 to 427 (25 residues), see Phobius details PF06808: DctM" amino acids 12 to 423 (412 residues), 277.5 bits, see alignment E=9e-87 TIGR00786: TRAP transporter, DctM subunit" amino acids 21 to 428 (408 residues), 367.2 bits, see alignment E=4.6e-114

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1037)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 5"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSG5 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Dshi_1037 TRAP dicarboxylate transporter, DctM subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MDPDIISLILIGAMLAMLAAGIWVSLTLMIVGFLGIALFSNAPAGAIMATTIWAQSWSWA
LTALPLFIWMGEILFRTKLAANMFNGLVPWMNALPGRLLHVNVASCGLFAAVSGSSAATT
ATIGRITIPELEKRDYDQNMIVGSLAGSATLGFLIPPSIILIVYGVAAEVSISRLFIAGI
LPGLMLMVLFMGYIMLWSLMHPDRTPPAEPRIPYLERIKATAGLFPMLGLIFAVIGSIYA
GLATPTEAAAVGVLGALLLSALSGTLNWASFRDSVAGATRTTCMITLILAGAAFLSVAMG
FTGIPRNLAAWVGSFELSQFQLLLALTLLFVVMGCFLDGISIVVLTASVIMPMVQGAGID
LIWFGIYLVVVIEMSQITPPVGINLFILQSMTRHDLLTVAKMAFPFFLVLVLATLLLILF
PGIATYLPSLMTRG