Protein Info for Dshi_1024 in Dinoroseobacter shibae DFL-12

Annotation: histone family protein nucleoid-structuring protein H-NS (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF00816: Histone_HNS" amino acids 66 to 105 (40 residues), 60.3 bits, see alignment E=5.6e-21

Best Hits

KEGG orthology group: K03746, DNA-binding protein H-NS (inferred from 100% identity to dsh:Dshi_1024)

Predicted SEED Role

"DNA-binding protein, H-NS family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSF2 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Dshi_1024 histone family protein nucleoid-structuring protein H-NS (RefSeq) (Dinoroseobacter shibae DFL-12)
MGIDLSNMSMEDLTALEKDIAKAKATLEKKRIAEARKAMEMAAKEYGMTVEDVLSSGPDR
KSGQKGVAKYANPANPDQTWTGRGRQPTWYREAIAAGTDPASMEI