Protein Info for Dshi_1022 in Dinoroseobacter shibae DFL-12

Annotation: 3-phosphoshikimate 1-carboxyvinyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF00275: EPSP_synthase" amino acids 14 to 436 (423 residues), 319.5 bits, see alignment E=1.5e-99 TIGR01356: 3-phosphoshikimate 1-carboxyvinyltransferase" amino acids 21 to 443 (423 residues), 380.6 bits, see alignment E=4.3e-118

Best Hits

Swiss-Prot: 100% identical to AROA_DINSH: 3-phosphoshikimate 1-carboxyvinyltransferase (aroA) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K00800, 3-phosphoshikimate 1-carboxyvinyltransferase [EC: 2.5.1.19] (inferred from 100% identity to dsh:Dshi_1022)

Predicted SEED Role

"5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSF0 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Dshi_1022 3-phosphoshikimate 1-carboxyvinyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MSAHGDPIPMTAHPSGPLSGTAQVPGDKSISHRSLILGALAVGETKVTGLLEGQDVLDTA
RAMQAFGAEVIQHAPGAWSVHGVGTGGFAEPEDVIDCGNSGTGVRLIMGAMATTPITATF
TGDASLRSRPMGRITDPLAGFGTTAVGRRGGRLPMTLTGAADPVPVRYTVPVPSAQVKSA
VLLAGLNAPGQTVVIEAEATRDHSERMLRGFGAEISVESAPEGNVITLTGQPELRPQTIV
VPRDPSSAAFPVAVGLIVPGSDVLVPGIGLNPTRAGLYTTLQEMGAELSFENMREEGGEP
VADLRARFSDAMQGIEVPPERAPSMIDEYPILSVIAAYATGRTVMRGVKELRVKESDRID
AMARGLEACGVRVEEDEDTLIVHGMGPGGVPGGATCASHLDHRIAMSFLCCGLAAQTPVS
VDDGGPIATSFPIFEPLMTALGATLTRDST