Protein Info for Dshi_1019 in Dinoroseobacter shibae DFL-12

Annotation: RNA modification enzyme, MiaB family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 6 to 432 (427 residues), 474.1 bits, see alignment E=4e-146 PF00919: UPF0004" amino acids 6 to 105 (100 residues), 113.8 bits, see alignment E=4.7e-37 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 6 to 434 (429 residues), 494.1 bits, see alignment E=4.1e-152 PF04055: Radical_SAM" amino acids 155 to 321 (167 residues), 94.9 bits, see alignment E=9.3e-31 PF01938: TRAM" amino acids 375 to 434 (60 residues), 25.5 bits, see alignment E=1.5e-09

Best Hits

Swiss-Prot: 100% identical to MIAB_DINSH: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 100% identity to dsh:Dshi_1019)

MetaCyc: 53% identical to isopentenyl-adenosine A37 tRNA methylthiolase (Escherichia coli K-12 substr. MG1655)
RXN0-5063 [EC: 2.8.4.3]

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSE7 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Dshi_1019 RNA modification enzyme, MiaB family (RefSeq) (Dinoroseobacter shibae DFL-12)
MADPKKLYIKTYGCQMNVYDSERMAEAMGGEGYVQTDRAEDADMILLNTCHIREKAAEKV
YSELGRFKPLKAEKPDLKIGVAGCVAQAEGAEIMRRQPLVDLVVGPQAYHRLPELTARAA
TGAKALDTDFPEEDKFDHLAARPKAKRGPTAFLTVQEGCDKFCAFCVVPYTRGAEVSRPA
ARVLTEARDLVERGVREITLLGQNVNAYHGHARGLAGLIWDLAEIDGLERIRFTTSHPND
MDDALIAAHGACDKLMPYLHLPVQSGSDRILKAMNRKHTAESYIRLIERIRAARPDILLS
GDFIVGFPGETDQDFADTMALVEAVGYGQAYSFKYSARPGTPAAEKEDVPGEVADARLQT
LQALLTRQQRAIQDAKVGTTARVLFEKPGRLPGQMVGKSEHLHAVHVAAPDAARGDLVRV
RIAESSANSLRGVLIAA