Protein Info for Dshi_0999 in Dinoroseobacter shibae DFL-12

Annotation: Bile acid:sodium symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 133 to 150 (18 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details PF13593: SBF_like" amino acids 7 to 278 (272 residues), 72.1 bits, see alignment E=5.4e-24 PF01758: SBF" amino acids 11 to 181 (171 residues), 126.1 bits, see alignment E=1.4e-40

Best Hits

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 100% identity to dsh:Dshi_0999)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSC7 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Dshi_0999 Bile acid:sodium symporter (RefSeq) (Dinoroseobacter shibae DFL-12)
MVGALEQTILALMIFVIMLGMGASLTPRDFYLALRRPYGLAIGVISQYGFMPFIGFLLAT
FLTVPEAIAVGILIMACMPGGTTSNIFTYFSKGNLALSVLMTVTSTVMGVIMIPIVLVLY
ASALNLDIPRENIIATLVLLLVPVAIGMVLRKLNANVGAVTEFMGSALALFFIVFLVVSW
IPRNWQFLMETTSATYIAAIGLGVFGIAIGYGFARALRLHPRNARTVGLETGIQNGPLAI
AIIVFTFDGAEAQSIMAVPVLYSLFIVIVATLVTLVFRRANTAAEQKLPDSLL