Protein Info for Dshi_0952 in Dinoroseobacter shibae DFL-12

Annotation: tryptophan synthase, alpha subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF00290: Trp_syntA" amino acids 17 to 251 (235 residues), 314.1 bits, see alignment E=2.7e-98 TIGR00262: tryptophan synthase, alpha subunit" amino acids 17 to 252 (236 residues), 262 bits, see alignment E=1.8e-82

Best Hits

Swiss-Prot: 80% identical to TRPA_RHOS5: Tryptophan synthase alpha chain (trpA) from Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 100% identity to dsh:Dshi_0952)

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRZ0 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Dshi_0952 tryptophan synthase, alpha subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MGYRDAGLTMTRIDETFARLRAEGKKAFVAYVMGGDPDYDTSLEIVRGLPAAGVDIIELG
MPFTDPMADGPTIQLAGQRALEAGQTLDKTLDLARALRETDDATPIVMMGYYNPIYSRGV
DRFLADAKDAGIDGLIVVDLPPEEDSELCIPAQAAGLNFIRLATPTTDDARLPKVLQNTS
GFVYYVSITGITGAAQAQASDVAPEVARIKSATDLPVIVGFGVKTPELAESIAGVADGTV
VGSAIVKMVEDGKPVPEILGFVADLAAGAHRA