Protein Info for Dshi_0890 in Dinoroseobacter shibae DFL-12

Annotation: Ornithine cyclodeaminase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF02423: OCD_Mu_crystall" amino acids 71 to 321 (251 residues), 196.6 bits, see alignment E=2.5e-62

Best Hits

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 100% identity to dsh:Dshi_0890)

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.12

Use Curated BLAST to search for 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRI5 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Dshi_0890 Ornithine cyclodeaminase (RefSeq) (Dinoroseobacter shibae DFL-12)
MLQKPDTDGLVIVTEEICQKVIDRDLAFAAVRDVFGAMARGDAYNFPVIREAIGHEDALY
GFKSGFDKAGMVLGVKAGGYWPNNMAKGIINHQSTVFLFDPDTGKLKALVGGNYLTAIRT
AASSAVSIDQLARKDAKVLGMVGAGHQSTFQLRAAVEQRDFEKVVCWNPHPDMIPNLGKV
AAEIGIPFEAVSREELGAQSDVIITITSAFEPLIEAGYIKPGTHLACMGTDTKGKQEVAA
ELVAKATLFTDEVAQSTTIGETQHAIASGAITQDDVTPIGKVINGDHPGRTSDDEITLFD
GTGVGLQDLAVAAVAAEQAVATGAATRVSL