Protein Info for Dshi_0881 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 101 (101 residues), 61.1 bits, see alignment E=1.2e-20 PF00528: BPD_transp_1" amino acids 112 to 319 (208 residues), 132.4 bits, see alignment E=1.7e-42

Best Hits

Swiss-Prot: 40% identical to Y209_BRUME: Putative peptide transport system permease protein BMEII0209 (BMEII0209) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to dsh:Dshi_0881)

MetaCyc: 38% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRH6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Dshi_0881 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MLAFIIRRVVQSIIVLLVVGLVAFSMFRFVGDPIDGLLGQERTIEDIERLRAQLGLDDPF
LVQYWDFLSRAFQGDLGISYRQSRPVAEILLERAPATLELALVSGVLAIFFGIVLGIFTA
IRRDGFAASAIMSISLIGVSLPTFLIGILLIYVFAVELNWLPSFGRGEVVDLGGWTTGFL
TASGLKALILPAITLGLYQMTLIMRLVRSEMLEVLRQDYIRFARARGLTEKAVNFRHALK
NTLVPVITVTGLQLGSIIAFAIITETVFQWPGVGLLFINAIQFVDIPVMAAYLMLISVMF
VGINLVVDLLYFAIDPRLRVDRSAAGGH