Protein Info for Dshi_0831 in Dinoroseobacter shibae DFL-12

Annotation: uracil phosphoribosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01091: uracil phosphoribosyltransferase
  • amino acids 6 to 210 (205 residues), 281.8 bits, E=1.7e-88
• PF14681: UPRTase
  • amino acids 8 to 209 (202 residues), 262 bits, E=3.4e-82
• PF00156: Pribosyltran
  • amino acids 69 to 171 (103 residues), 35.2 bits, E=7.8e-13

Best Hits

Swiss-Prot: 77% identical to UPP_PARDP: Uracil phosphoribosyltransferase (upp) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 100% identity to dsh:Dshi_0831)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• superpathway of pyrimidine ribonucleosides salvage (8/10 steps found)
• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

See A8LRC6 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Dshi_0831 uracil phosphoribosyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MTEHCTIVDHPLVQHKLTLMRDKGTSTSEFRRLLQEIALLLAYEVTRDLPLGTARIETPL
EPMDAPKLEGKKLALISILRAGNGLLDGVLQLIPSARVGFVGLYRDEETLEPVEYYFKVP
ENLEERMVIAVDPMLATGNSSAAAIDMLKKAGAKDIRFLCLLAAPEGVKRMKEAHPDVPI
VTAAVDSHLNEKGYIVPGLGDAGDRLFGTK