Protein Info for Dshi_0830 in Dinoroseobacter shibae DFL-12

Updated annotation (from data): Adenosine deaminase (EC 3.5.4.4)
Rationale: Specifically important for utilizing Adenosine. Automated validation from mutant phenotype: the predicted function (ADENODEAMIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: adenosine deaminase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR01430: adenosine deaminase" amino acids 4 to 321 (318 residues), 296.1 bits, see alignment E=1.4e-92 PF00962: A_deaminase" amino acids 5 to 323 (319 residues), 275.6 bits, see alignment E=2.8e-86

Best Hits

Swiss-Prot: 46% identical to ADE_CHESB: Adenine deaminase (Meso_3659) from Chelativorans sp. (strain BNC1)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 100% identity to dsh:Dshi_0830)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRC5 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Dshi_0830 Adenosine deaminase (EC 3.5.4.4) (Dinoroseobacter shibae DFL-12)
MKELPKLELHLHLEGAAPPAFIRGLAAEKSVNLSGIFDARGAYAYRDFVDFLRVYEAACT
VLQTPQDFYRLTRAVLEASSAEGVIYTEAFLSPDFCGGRDLDAWRDYLAAMTEAAADAEA
ADGIVMRGIVTCIRHFGPEAARETARCAAETAGAFITGFGIAGDEMKGAPKDFAYAFDMA
REAELQLTAHAGEWGGARSVRDAVRDLGVTRIGHGVQAIEDPALLEELAEAGITLEVCPG
SNVALGVYPNWRAHPIERLRKAGVPVTVSTDDPPFFHTTMSGEYENLAQSFGWELPDFAA
ITYAALDAAFCDTATREALRTRLAPTFGEFT