Protein Info for Dshi_0827 in Dinoroseobacter shibae DFL-12

Annotation: cytidine deaminase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF00383: dCMP_cyt_deam_1" amino acids 2 to 100 (99 residues), 58.2 bits, see alignment E=6.7e-20 TIGR01354: cytidine deaminase" amino acids 2 to 126 (125 residues), 135.5 bits, see alignment E=6.3e-44 PF08211: dCMP_cyt_deam_2" amino acids 3 to 66 (64 residues), 32.7 bits, see alignment E=8.2e-12

Best Hits

Swiss-Prot: 46% identical to CDD_BACSU: Cytidine deaminase (cdd) from Bacillus subtilis (strain 168)

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 100% identity to dsh:Dshi_0827)

MetaCyc: 46% identical to cytidine/deoxycytidine deaminase monomer (Bacillus subtilis subtilis 168)
Cytidine deaminase. [EC: 3.5.4.5]; 3.5.4.5 [EC: 3.5.4.5]

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRC2 at UniProt or InterPro

Protein Sequence (130 amino acids)

>Dshi_0827 cytidine deaminase (RefSeq) (Dinoroseobacter shibae DFL-12)
MELMEAARAVRENAYAPYSEFKVGAAIRAASGAVYTGCNVENVAYPEGTCAEAGAIAAMV
AAGETVLTEVAVIADSPSPVPPCGGCRQKLREFGAPETVVTLGTTGGARASMTLSELLPG
AFDQSHMAAP