Protein Info for Dshi_0824 in Dinoroseobacter shibae DFL-12

Annotation: histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 PF02518: HATPase_c" amino acids 131 to 237 (107 residues), 68.2 bits, see alignment E=8.3e-23 PF00072: Response_reg" amino acids 260 to 363 (104 residues), 69.7 bits, see alignment E=2.4e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0824)

Predicted SEED Role

"Aerobic respiration control sensor protein arcB (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRB9 at UniProt or InterPro

Protein Sequence (509 amino acids)

>Dshi_0824 histidine kinase (RefSeq) (Dinoroseobacter shibae DFL-12)
MTSPDTALQRSDEPANAETSDQISLLSHDIRGAMSDVIGGLRLVDMGVLEPDTRAQLERV
RSSGEVLARLVEEILSWANEGEDAPRRPGQRLNLGRFLHDLDSRWTGRAVASGLRFRMTI
ADTVPSVVGLDRVALERILGNLISNALKYTDRGEVQLDISLLPSRDLQFRVLDQGPGFSD
AALALLFEMRGRPDNAPKPGTGLGLHIAKELSDDMGGRLMVANRAGGGALVSLSIPDGVW
TTPDTAPAQSRSHDLSGKHILVAEDNETNQILTTQMLEALGATSEIAVDGVAALDALDQR
DFDLALIDIEMPRLNGIEVIRTIRTRNDAKAKMPLIALTAYVLRSNREAIYQAGSDAIIA
KPIMSLESFAETLAQHLGAPTTSDELEASNVVSMPDRSRFDRLLEIAGTDGARELLSRLT
ADLERVRDNLCLAIPRLDQSMLRAETHVLISLAGAVGADRLHTLASTLNAAAHRMDECEI
VTLGSEAKSRIDDLLRVIEREAAERIPTV