Protein Info for Dshi_0822 in Dinoroseobacter shibae DFL-12

Annotation: NAD(+) kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01513: NAD_kinase" amino acids 33 to 86 (54 residues), 31.7 bits, see alignment E=1.7e-11 PF20143: NAD_kinase_C" amino acids 115 to 182 (68 residues), 34.9 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 73% identical to NADK_RHOS5: NAD kinase (nadK) from Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 100% identity to dsh:Dshi_0822)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRB7 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Dshi_0822 NAD(+) kinase (RefSeq) (Dinoroseobacter shibae DFL-12)
MQIREKIAFLASPADVAQQARAALSAVHGHVPPEEADVIVALGGDGFMLQTLHATESLRA
PVYGMNCGSVGFMMNEYSEAALPERLAAAEEEVINPLHMKAIGRDGTVVEALAINEVALL
RAGSQAAKLRISVDGRVRMDELVCDGALVATPAGSTAYNYSAHGPILPIGSDVLALTAMS
AFRPRRWRGALLPKTAMVRFDVLEPSKRPVMADADSRSNHEVVSVEIRSEPSVRHRILFD
PGHGLEERLIREQFV