Protein Info for Dshi_0753 in Dinoroseobacter shibae DFL-12

Annotation: high-affinity nickel-transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 55 to 74 (20 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details PF03824: NicO" amino acids 60 to 316 (257 residues), 84.8 bits, see alignment E=3.4e-28

Best Hits

KEGG orthology group: K08970, nickel/cobalt exporter (inferred from 100% identity to dsh:Dshi_0753)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQV5 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Dshi_0753 high-affinity nickel-transporter (RefSeq) (Dinoroseobacter shibae DFL-12)
MRALGAGAALLLLGGLAFLLWGGGGDGIARWAASQQREVQDALAGQLRALRVGEAGALAG
FLGVCFAYGFFHAAGPGHGKVVIGGYGVARRISMLRLSGVALIASLGQAATAIVLVGVGA
WVFQASTAQLTGVADDWFAPASAAAILVLGLWLVWRGVARLRAARRVEAHHHDHHDHHHG
HDHDHDHDHDHGHGDGACETCGHAHAPDASAVLAARGPREILALIGAVAIRPCTGALFVL
ILGLRLQIEAAAVAGVVAMALGTASVTVAVAVAATGLRESSALASGGWSQARHLGSVLEI
GAGVLVALLAWGLLQAGM